Structure of PDB 3r2c Chain A Binding Site BS01

Receptor Information
>3r2c Chain A (length=138) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKL
VDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP
GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r2c Structural basis for RNA recognition by NusB and NusE in the initiation of transcription antitermination.
Resolution1.902 Å
Binding residue
(original residue number in PDB)		M1 R2 K5 H68 K70 L77 E81 E99 G101 R102 F104 I105 D106 V108 D109 K112 K118 F122 N124 G125 S128 A129 K132
Binding residue
(residue number reindexed from 1)		M1 R2 K5 H68 K70 L77 E81 E99 G101 R102 F104 I105 D106 V108 D109 K112 K118 F122 N124 G125 S128 A129 K132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3r2c, PDBe:3r2c, PDBj:3r2c
PDBsum3r2c
PubMed21652641
UniProtO66530|NUSB_AQUAE Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]