Structure of PDB 3qzv Chain A Binding Site BS01

Receptor Information
>3qzv Chain A (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQ
STEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYG
VIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQC
AEVLESFFVQKLKGFKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qzv Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
Resolution1.999 Å
Binding residue
(original residue number in PDB)		V97 D104 Y146 Y147 N148 P149 F154
Binding residue
(residue number reindexed from 1)		V90 D97 Y139 Y140 N141 P142 F147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0016589 NURF complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qzv, PDBe:3qzv, PDBj:3qzv
PDBsum3qzv
PubMed21596426
UniProtQ12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF (Gene Name=BPTF)

[Back to BioLiP]