Structure of PDB 3qzt Chain A Binding Site BS01

Receptor Information
>3qzt Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDL
ATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFF
VQKLKGFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qzt Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		W91 V97 N100 D101 Y147 N148 F154
Binding residue
(residue number reindexed from 1)		W26 V32 N35 D36 Y82 N83 F89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0016589 NURF complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qzt, PDBe:3qzt, PDBj:3qzt
PDBsum3qzt
PubMed21596426
UniProtQ12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF (Gene Name=BPTF)

[Back to BioLiP]