Structure of PDB 3qyx Chain A Binding Site BS01

Receptor Information
>3qyx Chain A (length=131) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSG
NRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRR
IAQRAHGLPSAAQQKVLDRIDELRRAEGIDA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qyx Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis.
Resolution3.75 Å
Binding residue
(original residue number in PDB)		S42 Y45 S58
Binding residue
(residue number reindexed from 1)		S40 Y43 S56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0042802 identical protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0050708 regulation of protein secretion
GO:0052572 response to host immune response
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qyx, PDBe:3qyx, PDBj:3qyx
PDBsum3qyx
PubMed21883526
UniProtP9WJB7|ESPR_MYCTU Nucleoid-associated protein EspR (Gene Name=espR)

[Back to BioLiP]