Structure of PDB 3qyn Chain A Binding Site BS01

Receptor Information

>3qyn Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIK
VMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHL
IRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVG
GMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI

Ligand information

>3qyn Chain E (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacatgttttaaaacatgttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3qyn Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	N270 S272 R304 C306 A307 R311
Binding residue (residue number reindexed from 1)	N145 S147 R179 C181 A182 R186

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3qyn, PDBe:3qyn, PDBj:3qyn
PDBsum	3qyn
PubMed	21464285
UniProt	Q9H3D4\|P63_HUMAN Tumor protein 63 (Gene Name=TP63)

[Back to BioLiP]