Structure of PDB 3qyn Chain A Binding Site BS01

Receptor Information
>3qyn Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIK
VMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHL
IRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVG
GMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qyn Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
N270 S272 R304 C306 A307 R311
Binding residue
(residue number reindexed from 1)
N145 S147 R179 C181 A182 R186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3qyn, PDBe:3qyn, PDBj:3qyn
PDBsum3qyn
PubMed21464285
UniProtQ9H3D4|P63_HUMAN Tumor protein 63 (Gene Name=TP63)

[Back to BioLiP]