Structure of PDB 3qxd Chain A Binding Site BS01

Receptor Information
>3qxd Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
CEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPN
VLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPF
LPSTEDVYDCRVEHWGLDEPLLKHWEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qxd Conformational lability in the class II MHC 310 helix and adjacent extended strand dictate HLA-DM susceptibility and peptide exchange.
Resolution2.302 Å
Binding residue
(original residue number in PDB)
Q9 F22 F24 A52 S53 G58 A59 N62 V65 N69 M73
Binding residue
(residue number reindexed from 1)
Q6 F19 F21 A49 S50 G55 A56 N59 V62 N66 M70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3qxd, PDBe:3qxd, PDBj:3qxd
PDBsum3qxd
PubMed22084083
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]