Structure of PDB 3qrx Chain A Binding Site BS01

Receptor Information
>3qrx Chain A (length=145) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKM
ISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTIT
IKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
Ligand information
>3qrx Chain B (length=20) Species: 7460 (Apis mellifera) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IGAVLKVLTTGLPALISWIK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qrx The structure, molecular dynamics, and energetics of centrin-melittin complex.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		E132 E138
Binding residue
(residue number reindexed from 1)		E113 E119
Enzymatic activity
Catalytic site (original residue number in PDB) I30 V126 M163
Catalytic site (residue number reindexed from 1) I11 V107 M144
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0045504 dynein heavy chain binding
GO:0046872 metal ion binding
Biological Process
GO:0051301 cell division
Cellular Component
GO:0036156 inner dynein arm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qrx, PDBe:3qrx, PDBj:3qrx
PDBsum3qrx
PubMed21989934
UniProtP05434|CATR_CHLRE Caltractin

[Back to BioLiP]