Structure of PDB 3qq3 Chain A Binding Site BS01

Receptor Information
>3qq3 Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVP
WIQQEGQEYWDRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYG
CYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAA
DEAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qq3 Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides.
Resolution2.59 Å
Binding residue
(original residue number in PDB)		Y7 E63 N66 E69 T73 Y74 Y84 Y99 D116 T143 K146 W147 A150 E152 R156 Y159 L163 S167 R170 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 N66 E69 T73 Y74 Y84 Y99 D116 T143 K146 W147 A150 E152 R156 Y159 L163 S167 R170 Y171
Enzymatic activity
Enzyme Commision number ?
External links