Structure of PDB 3qo2 Chain A Binding Site BS01

Receptor Information
>3qo2 Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVL
LEFRKKIAENK
Ligand information
>3qo2 Chain P (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qo2 Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		E56 D57 V58 F59 E60 V61 W80 Y83 E91 H95 D98 C99 E101
Binding residue
(residue number reindexed from 1)		E3 D4 V5 F6 E7 V8 W27 Y30 E38 H42 D45 C46 E48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3qo2, PDBe:3qo2, PDBj:3qo2
PDBsum3qo2
PubMed21419134
UniProtQ99549|MPP8_HUMAN M-phase phosphoprotein 8 (Gene Name=MPHOSPH8)

[Back to BioLiP]