Structure of PDB 3qmd Chain A Binding Site BS01

Receptor Information
>3qmd Chain A (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARE
SYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qmd The structural basis for selective binding of non-methylated CpG islands by the CFP1 CXXC domain.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K202 R204
Binding residue
(residue number reindexed from 1)		K34 R36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3qmd, PDBe:3qmd, PDBj:3qmd
PDBsum3qmd
PubMed21407193
UniProtQ9P0U4|CXXC1_HUMAN CXXC-type zinc finger protein 1 (Gene Name=CXXC1)

[Back to BioLiP]