Structure of PDB 3qjp Chain A Binding Site BS01

Receptor Information
>3qjp Chain A (length=240) Species: 53953 (Pyrococcus horikoshii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGF
WTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPE
FKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDL
YPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSY
IRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qjp Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
Resolution3.2986 Å
Binding residue
(original residue number in PDB)		F18 R54 V57 R60 P64 I68 W147 D148 K187 K189 P190 T191 R192 R201 L204 M205 V206
Binding residue
(residue number reindexed from 1)		F19 R55 V58 R61 P65 I69 W148 D149 K188 K190 P191 T192 R193 R202 L205 M206 V207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qjp, PDBe:3qjp, PDBj:3qjp
PDBsum3qjp
PubMed
UniProtO58088|CAS6L_PYRHO Putative CRISPR-associated endoribonuclease-like protein Cas6nc (Gene Name=cas6nc)

[Back to BioLiP]