Structure of PDB 3qjm Chain A Binding Site BS01

Receptor Information
>3qjm Chain A (length=98) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEGGV
AWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qjm The structural flexibility of the shank1 PDZ domain is important for its binding to different ligands
Resolution2.311 Å
Binding residue
(original residue number in PDB)		G673 F674 F676 V677 L678 R679 G680 E703 H735
Binding residue
(residue number reindexed from 1)		G18 F19 F21 V22 L23 R24 G25 E43 H75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3qjm, PDBe:3qjm, PDBj:3qjm
PDBsum3qjm
PubMed21376703
UniProtQ9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 (Gene Name=Shank1)

[Back to BioLiP]