Structure of PDB 3qj6 Chain A Binding Site BS01

Receptor Information
>3qj6 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHAFKPGDLVFAKMKGYPHWPARIDDIAAVKPPPNKYPIFFFGTHETAFL
GPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qj6 Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y18 A32 V33 F44 E49 T50
Binding residue
(residue number reindexed from 1)
Y17 A29 V30 F41 E46 T47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3qj6, PDBe:3qj6, PDBj:3qj6
PDBsum3qj6
PubMed21720545
UniProtQ7Z4V5|HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 (Gene Name=HDGFL2)

[Back to BioLiP]