Structure of PDB 3qiw Chain A Binding Site BS01

Receptor Information
>3qiw Chain A (length=179) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFA
SFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEP
NILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLT
FLPSTDDFYDCEVDHWGLEEPLRKHWEFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qiw Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q9 A52 S53 F54 G58 N62 V65 D66 N69 M73
Binding residue
(residue number reindexed from 1)		Q7 A50 S51 F52 G56 N60 V63 D64 N67 M71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qiw, PDBe:3qiw, PDBj:3qiw
PDBsum3qiw
PubMed21490152
UniProtP04224|HA22_MOUSE H-2 class II histocompatibility antigen, E-K alpha chain

[Back to BioLiP]