Structure of PDB 3qib Chain A Binding Site BS01

Receptor Information

>3qib Chain A (length=180) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAK
FASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLG
EPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHY
LTFLPSTDDFYDCEVDHWGLEEPLRKHWEF

Ligand information

>3qib Chain P (length=13) Species: 7130 (Manduca sexta) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ADLIAYLKQATKG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3qib Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Q9 E11 F51 A52 S53 F54 E55 N62 D66 N69 M73
Binding residue (residue number reindexed from 1)	Q9 E11 F51 A52 S53 F54 E55 N62 D66 N69 M73

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3qib, PDBe:3qib, PDBj:3qib
PDBsum	3qib
PubMed	21490152
UniProt	P04224\|HA22_MOUSE H-2 class II histocompatibility antigen, E-K alpha chain

[Back to BioLiP]