Structure of PDB 3q33 Chain A Binding Site BS01

Receptor Information
>3q33 Chain A (length=394) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQ
HFFSLFHQGKVFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSV
RDITKIILEFILSIDPNYYLQKVKPAIRSSPELISAASTPARTLRILARR
LKQSGSTVLKEQQDLYLSFTCPREILTKICLFTRPASQYLFPDSSKNSKK
HILNGEELMKWWGFILDRLLIECFQNDTQAKLRIPGEDPARVRSYLRGMK
YPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEEDRLLKVSLSS
FWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA
IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q33 Structure of the Rtt109-AcCoA/Vps75 Complex and Implications for Chaperone-Mediated Histone Acetylation.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G367 E368
Binding residue
(residue number reindexed from 1)		G357 E358
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0010484 histone H3 acetyltransferase activity
GO:0016740 transferase activity
GO:0032931 histone H3K56 acetyltransferase activity
GO:0036408 histone H3K14 acetyltransferase activity
GO:0043992 histone H3K9 acetyltransferase activity
GO:0043994 histone H3K23 acetyltransferase activity
GO:0044017 histone H3K27 acetyltransferase activity
GO:0061733 peptide-lysine-N-acetyltransferase activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006974 DNA damage response
GO:0010468 regulation of gene expression
GO:0010526 retrotransposon silencing
GO:0033554 cellular response to stress
GO:0036211 protein modification process
GO:0043007 maintenance of rDNA
GO:1990414 replication-born double-strand break repair via sister chromatid exchange
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0070775 H3 histone acetyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3q33, PDBe:3q33, PDBj:3q33
PDBsum3q33
PubMed21256037
UniProtQ07794|RT109_YEAST Histone acetyltransferase RTT109 (Gene Name=RTT109)

[Back to BioLiP]