Structure of PDB 3q0d Chain A Binding Site BS01

Receptor Information
>3q0d Chain A (length=145) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDGELVATSIVSS
GGYNDVLDNSDVLIYTGQGGNVEPPKDQQLVTGNLALKNSINKKNPVRVI
RGIKKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q0d A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
Resolution2.3704 Å
Binding residue
(original residue number in PDB)
Y378 R379 S391 Q392 S393 G394 S412 S413 G415 Y416 D418 Y428 T429 Q431
Binding residue
(residue number reindexed from 1)
Y17 R18 S30 Q31 S32 G33 S49 S50 G52 Y53 D55 Y65 T66 Q68
Binding affinityPDBbind-CN: Kd=5uM
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.
External links
PDB RCSB:3q0d, PDBe:3q0d, PDBj:3q0d
PDBsum3q0d
PubMed21245167
UniProtO82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 (Gene Name=SUVH5)

[Back to BioLiP]