Structure of PDB 3pwv Chain A Binding Site BS01

Receptor Information
>3pwv Chain A (length=274) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFTRFDSDAPNPRDEPRVPW
MEQEGPEYWDRNTRIYKDTAQIFRANLNTALGYYNQSEAGSHTFQEMYGC
YVGPDGRLLLGFMQFAYDGRDYIALNEDLRSWTAADTAAQITKRKWEAAG
EAERQRNYLEGRCVEGLRRYLENGKDTLLRADPPKAHVTHHPISDREVTL
RCWALGFYPEEISLTWQHEGEDQTQDMELVETRPSGDGTFQKWAALVVPS
GEEQRYTCRVQHEGLQEPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pwv Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
Resolution2.696 Å
Binding residue
(original residue number in PDB)		Y6 R61 Y66 T69 I72 N76 Y83 F94 Y98 Y122 T142 K145 W146 E151 R154 Y158 R162 Y170
Binding residue
(residue number reindexed from 1)		Y6 R61 Y66 T69 I72 N76 Y83 F94 Y98 Y122 T142 K145 W146 E151 R154 Y158 R162 Y170
Enzymatic activity
Enzyme Commision number ?
External links