Structure of PDB 3pwu Chain A Binding Site BS01

Receptor Information
>3pwu Chain A (length=274) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFTRFDSDAPNPRDEPRVPW
MEQEGPEYWDRNTRIYKDTAQIFRANLNTALGYYNQSEAGSHTFQEMYGC
YVGPDGRLLLGFMQFAYDGRDYIALNEDLRSWTAADTAAQITKRKWEAAG
EAERQRNYLEGRCVEGLRRYLENGKDTLLRADPPKAHVTHHPISDREVTL
RCWALGFYPEEISLTWQHEGEDQTQDMELVETRPSGDGTFQKWAALVVPS
GEEQRYTCRVQHEGLQEPLTLRWE
Ligand information
>3pwu Chain C (length=9) Species: 36409 (Rinderpest virus (strain RBOK)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IPAYGVLTI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pwu Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
Resolution1.899 Å
Binding residue
(original residue number in PDB)		Y6 R61 N62 I65 Y66 I72 N76 Y83 Y98 T142 K145 W146 E151 Q155 Y158 Y170
Binding residue
(residue number reindexed from 1)		Y6 R61 N62 I65 Y66 I72 N76 Y83 Y98 T142 K145 W146 E151 Q155 Y158 Y170
Enzymatic activity
Enzyme Commision number ?
External links