Structure of PDB 3pw7 Chain A Binding Site BS01

Receptor Information
>3pw7 Chain A (length=343) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANY
EARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEK
IEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNK
VFAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLG
INKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRI
VTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSR
GRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pw7 Bypass of Aflatoxin B(1) Adducts by the Sulfolobus solfataricus DNA Polymerase IV.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
F36 S37 R39 F40 S43 G44 A45 G221 E222 A223 R245 K246 S247 I248 G249 R250 I251 T253 L296 R334 R335 R339
Binding residue
(residue number reindexed from 1)
F35 S36 R38 F39 S42 G43 A44 G220 E221 A222 R244 K245 S246 I247 G248 R249 I250 T252 L295 R333 R334 R338
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0046872 metal ion binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0042276 error-prone translesion synthesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3pw7, PDBe:3pw7, PDBj:3pw7
PDBsum3pw7
PubMed21790157
UniProtQ97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)

[Back to BioLiP]