Structure of PDB 3pvv Chain A Binding Site BS01

Receptor Information
>3pvv Chain A (length=96) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLP
KIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pvv Structural and Thermodynamic Signatures of DNA Recognition by Mycobacterium tuberculosis DnaA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R444 Q445 R468 D469 T471 T472 Y475 K479
Binding residue
(residue number reindexed from 1)
R34 Q35 R58 D59 T61 T62 Y65 K69
Binding affinityPDBbind-CN: Kd=36nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005524 ATP binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006270 DNA replication initiation
GO:0006275 regulation of DNA replication

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3pvv, PDBe:3pvv, PDBj:3pvv
PDBsum3pvv
PubMed21620858
UniProtA5TY69|DNAA_MYCTA Chromosomal replication initiator protein DnaA (Gene Name=dnaA)

[Back to BioLiP]