Structure of PDB 3puj Chain A Binding Site BS01

Receptor Information
>3puj Chain A (length=533) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMT
EGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAA
HVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADS
FQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLA
QLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAM
SYDLLPIENDVYKYETVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKD
FSSSKMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRV
EQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGI
TEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTRKERISEQTYQLSRWT
PIIKDIMEDTIEDKLDTKHYPYISRSGPRLIIFILGGVSLNEMRCAYEVT
QANGKWEVLIGSTHILTPQKLLDTLKKLNKTDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3puj Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
Resolution3.313 Å
Binding residue
(original residue number in PDB)		F115 V119 I127 T129 L130 T131 E132 I133
Binding residue
(residue number reindexed from 1)		F113 V117 I125 T127 L128 T129 E130 I131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000149 SNARE binding
GO:0005515 protein binding
GO:0017075 syntaxin-1 binding
GO:0019901 protein kinase binding
GO:0019904 protein domain specific binding
GO:0019905 syntaxin binding
GO:0042802 identical protein binding
GO:0043274 phospholipase binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0002576 platelet degranulation
GO:0003006 developmental process involved in reproduction
GO:0006886 intracellular protein transport
GO:0006887 exocytosis
GO:0006904 vesicle docking involved in exocytosis
GO:0007269 neurotransmitter secretion
GO:0007274 neuromuscular synaptic transmission
GO:0007412 axon target recognition
GO:0010807 regulation of synaptic vesicle priming
GO:0015031 protein transport
GO:0016082 synaptic vesicle priming
GO:0016188 synaptic vesicle maturation
GO:0016192 vesicle-mediated transport
GO:0031333 negative regulation of protein-containing complex assembly
GO:0031338 regulation of vesicle fusion
GO:0032229 negative regulation of synaptic transmission, GABAergic
GO:0032355 response to estradiol
GO:0035493 SNARE complex assembly
GO:0035544 negative regulation of SNARE complex assembly
GO:0043306 positive regulation of mast cell degranulation
GO:0043524 negative regulation of neuron apoptotic process
GO:0045921 positive regulation of exocytosis
GO:0045956 positive regulation of calcium ion-dependent exocytosis
GO:0050821 protein stabilization
GO:0051402 neuron apoptotic process
GO:0051649 establishment of localization in cell
GO:0060292 long-term synaptic depression
GO:0070527 platelet aggregation
GO:0071346 cellular response to type II interferon
GO:0072659 protein localization to plasma membrane
GO:0099525 presynaptic dense core vesicle exocytosis
GO:0106022 positive regulation of vesicle docking
GO:1903296 positive regulation of glutamate secretion, neurotransmission
GO:2000367 regulation of acrosomal vesicle exocytosis
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030141 secretory granule
GO:0030424 axon
GO:0031091 platelet alpha granule
GO:0032991 protein-containing complex
GO:0043195 terminal bouton
GO:0045335 phagocytic vesicle
GO:0048471 perinuclear region of cytoplasm
GO:0048787 presynaptic active zone membrane
GO:0098688 parallel fiber to Purkinje cell synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098831 presynaptic active zone cytoplasmic component
GO:0098888 extrinsic component of presynaptic membrane
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3puj, PDBe:3puj, PDBj:3puj
PDBsum3puj
PubMed21193638
UniProtP61765|STXB1_RAT Syntaxin-binding protein 1 (Gene Name=Stxbp1)

[Back to BioLiP]