Structure of PDB 3pth Chain A Binding Site BS01

Receptor Information
>3pth Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEL
LHMLESPESLRSKVDEAVAVLQAHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pth LARP4B binds to the PABC1 MLLE domain via a variant PAM2 motif
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Q560 G563 E564 G579 K580 G583 M584 L586 E587 A610 V613
Binding residue
(residue number reindexed from 1)		Q17 G20 E21 G36 K37 G40 M41 L43 E44 A67 V70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3pth, PDBe:3pth, PDBj:3pth
PDBsum3pth
PubMed
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]