Structure of PDB 3pqz Chain A Binding Site BS01

Receptor Information
>3pqz Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRPQGFVLSLCHL
QKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLR
HCCT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pqz Structural basis of binding by cyclic nonphosphorylated Peptide antagonists of grb7 implicated in breast cancer progression
Resolution2.413 Å
Binding residue
(original residue number in PDB)		R438 K478 H479 Y480 L481 M495 D496 Q499
Binding residue
(residue number reindexed from 1)		R15 K54 H55 Y56 L57 M71 D72 Q75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3pqz, PDBe:3pqz, PDBj:3pqz
PDBsum3pqz
PubMed21802427
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]