Structure of PDB 3poa Chain A Binding Site BS01

Receptor Information
>3poa Chain A (length=96) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDG
QVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMHPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3poa Structural and functional analysis of phosphothreonine-dependent FHA domain interactions
Resolution2.01 Å
Binding residue
(original residue number in PDB)
R29 T40 G41 S43 R44 T64 N65 G88
Binding residue
(residue number reindexed from 1)
R26 T37 G38 S40 R41 T61 N62 G85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3poa, PDBe:3poa, PDBj:3poa
PDBsum3poa
PubMed21134638
UniProtP71590|FHAA_MYCTU FHA domain-containing protein FhaA (Gene Name=fhaA)

[Back to BioLiP]