Structure of PDB 3plu Chain A Binding Site BS01

Receptor Information
>3plu Chain A (length=74) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGS
VLKDHISLEDYEVHDQTNLELYYL
Ligand information
>3plu Chain C (length=18) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LSIEETNEIREKLGMKPI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3plu Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		M1 K17 D22 D26 K29 V30 L33
Binding residue
(residue number reindexed from 1)		M2 K18 D23 D27 K30 V31 L34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031386 protein tag activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000753 cell morphogenesis involved in conjugation with cellular fusion
GO:0033120 positive regulation of RNA splicing
GO:0036211 protein modification process
GO:0043687 post-translational protein modification
Cellular Component
GO:0005575 cellular_component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3plu, PDBe:3plu, PDBj:3plu
PDBsum3plu
PubMed21614000
UniProtQ6Q546|HUB1_YEAST Ubiquitin-like modifier HUB1 (Gene Name=HUB1)

[Back to BioLiP]