Structure of PDB 3pkn Chain A Binding Site BS01

Receptor Information
>3pkn Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEL
LHMLESPESLRSKVDEAVAVLQAHQAKEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pkn La-Related Protein 4 Binds Poly(A), Interacts with the Poly(A)-Binding Protein MLLE Domain via a Variant PAM2w Motif, and Can Promote mRNA Stability.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Q560 G563 E564 F567 G579 K580 G583 M584 E587 V613 H617
Binding residue
(residue number reindexed from 1)		Q17 G20 E21 F24 G36 K37 G40 M41 E44 V70 H74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3pkn, PDBe:3pkn, PDBj:3pkn
PDBsum3pkn
PubMed21098120
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]