Structure of PDB 3pk1 Chain A Binding Site BS01

Receptor Information
>3pk1 Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLYRQSLEIISRYLREQATGAKATSRKALETLRRVGDGVQRNHETAFQGM
LRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTI
NQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
Ligand information
>3pk1 Chain B (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASTKKLSECLKRIGDELDSNMELQRMI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pk1 Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis
Resolution2.486 Å
Binding residue
(original residue number in PDB)		H224 M231 H252 V253 D256 N260 G262 R263 T266 F318 F319
Binding residue
(residue number reindexed from 1)		H43 M50 H71 V72 D75 N79 G81 R82 T85 F137 F138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3pk1, PDBe:3pk1, PDBj:3pk1
PDBsum3pk1
PubMed21199865
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]