Structure of PDB 3pf5 Chain A Binding Site BS01

Receptor Information
>3pf5 Chain A (length=66) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFE
IVEGNRGPQAANVTKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pf5 RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
Resolution1.68 Å
Binding residue
(original residue number in PDB)		W8 F17 D25
Binding residue
(residue number reindexed from 1)		W8 F17 D25
Binding affinityPDBbind-CN: Kd=336nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
Biological Process
GO:0010468 regulation of gene expression
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pf5, PDBe:3pf5, PDBj:3pf5
PDBsum3pf5
PubMed22128343
UniProtP32081|CSPB_BACSU Cold shock protein CspB (Gene Name=cspB)

[Back to BioLiP]