Structure of PDB 3p9y Chain A Binding Site BS01

Receptor Information
>3p9y Chain A (length=198) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMTDPSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPG
MAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPE
RFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAE
DALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p9y cis-Proline-mediated Ser(P)5 Dephosphorylation by the RNA Polymerase II C-terminal Domain Phosphatase Ssu72.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D13 S14 S15 M17 N18 R19 K44 L45 P46 G47 M48 A49 F50 M85 N144
Binding residue
(residue number reindexed from 1)		D16 S17 S18 M20 N21 R22 K47 L48 P49 G50 M51 A52 F53 M88 N147
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0016791 phosphatase activity
GO:0017018 myosin phosphatase activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0031124 mRNA 3'-end processing
Cellular Component
GO:0005634 nucleus
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3p9y, PDBe:3p9y, PDBj:3p9y
PDBsum3p9y
PubMed21159777
UniProtQ9VWE4

[Back to BioLiP]