Structure of PDB 3p9g Chain A Binding Site BS01

Receptor Information
>3p9g Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGGSRELMNL
TGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDA
NGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>3p9g Chain B (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEPTAPPEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p9g Elucidation of New Binding Interactions with the Tumor Susceptibility Gene 101 (Tsg101) Protein Using Modified HIV-1 Gag-p6 Derived Peptide Ligands.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		D34 K36 T56 G57 T58 Y63 Y68 N69 M95 P139 V141 F142 S143
Binding residue
(residue number reindexed from 1)		D33 K35 T51 G52 T53 Y58 Y63 N64 M90 P134 V136 F137 S138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:3p9g, PDBe:3p9g, PDBj:3p9g
PDBsum3p9g
PubMed21643473
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]