Structure of PDB 3p89 Chain A Binding Site BS01

Receptor Information
>3p89 Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQ
VLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQ
YDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAELLGRLTELRTFNHHHA
EMLMSWRVNDHKFTPLLEEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p89 Conformationally constrained farnesoid X receptor (FXR) agonists: Heteroaryl replacements of the naphthalene.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K303 H313 I317 K321 P463 E467
Binding residue
(residue number reindexed from 1)		K57 H67 I71 K75 P215 E219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3p89, PDBe:3p89, PDBj:3p89
PDBsum3p89
PubMed21256005
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]