Structure of PDB 3oyp Chain A Binding Site BS01

Receptor Information

>3oyp Chain A (length=174) Species: 11116 (Hepatitis C virus (isolate Japanese))

PITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGV
CWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGS
SDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVV
GIFRAAVCTRGVAKAVDFIPVESM

Ligand information

>3oyp Chain C (length=12) Species: 11116 (Hepatitis C virus (isolate Japanese))

GSVVIVGRIILS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3oyp Selective irreversible inhibition of a protease by targeting a noncatalytic cysteine.
• Resolution: 2.76 Å
• Binding residue (original residue number in PDB): I3 T4 A5 Y6 S7 Q8 T10 R11 C16 S20 Q28 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64 A65
• Binding residue (residue number reindexed from 1): I2 T3 A4 Y5 S6 Q7 T9 R10 C15 S19 Q27 D29 E31 V32 Q33 V34 L35 S36 K61 T62 L63 A64

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H56 D80 G136 S138
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:3oyp, PDBe:3oyp, PDBj:3oyp
• PDBsum: 3oyp
• PubMed: 21113170
• UniProt: P26662|POLG_HCVJA Genome polyprotein