Structure of PDB 3oxr Chain A Binding Site BS01

Receptor Information
>3oxr Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGQEQRYTCHVQHEGLPKPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oxr Structural insights into the binding of hepatitis B virus core peptide to HLA-A2 alleles: Towards designing better vaccines.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 A69 H70 T73 V76 D77 T80 Y84 R97 Y99 H114 Y116 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 V67 A69 H70 T73 V76 D77 T80 Y84 R97 Y99 H114 Y116 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links