Structure of PDB 3ox8 Chain A Binding Site BS01

Receptor Information
>3ox8 Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETA
HEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGQEQRYTCHVQHEGLPKPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ox8 Structural insights into the binding of hepatitis B virus core peptide to HLA-A2 alleles: Towards designing better vaccines.
Resolution2.16 Å
Binding residue
(original residue number in PDB)
Y7 E63 K66 V67 A69 H70 V76 D77 Y84 R97 Y99 T143 K146 W147 E152 Q155 W156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 K66 V67 A69 H70 V76 D77 Y84 R97 Y99 T143 K146 W147 E152 Q155 W156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links