Structure of PDB 3owt Chain A Binding Site BS01

Receptor Information
>3owt Chain A (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISG
DYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDN
VNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Ligand information
>3owt Chain C (length=20) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KMIDFATLSKLKKKYQIILD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3owt A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		I724 P730 A733 E734 K748 T752 S753 L755 T756 S759 G760 D761 L762 M817 F821
Binding residue
(residue number reindexed from 1)		I48 P54 A57 E58 K72 T76 S77 L79 T80 S83 G84 D85 L86 M141 F145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Biological Process
External links
PDB RCSB:3owt, PDBe:3owt, PDBj:3owt
PDBsum3owt
PubMed21217703
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]