Structure of PDB 3ov1 Chain A Binding Site BS01

Receptor Information
>3ov1 Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGND
VQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV
P
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ov1 Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R67 R86 S88 S90 H107 F108 K109 L120 W121 P155
Binding residue
(residue number reindexed from 1)		R13 R32 S34 S36 H53 F54 K55 L66 W67 P101
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ov1, PDBe:3ov1, PDBj:3ov1
PDBsum3ov1
PubMed22007755
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]