Structure of PDB 3osg Chain A Binding Site BS01

Receptor Information
>3osg Chain A (length=110) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQVNKAAKKQKFTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRW
KNYLAPSISHTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNR
WVTISNKLGI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3osg Molecular basis of the recognition of the ap65-1 gene transcription promoter elements by a Myb protein from the protozoan parasite Trichomonas vaginalis.
Resolution1.997 Å
Binding residue
(original residue number in PDB)		K49 Q50 K51 R84 Q85 R89 Y93 N139 V142 T143 N146
Binding residue
(residue number reindexed from 1)		K9 Q10 K11 R44 Q45 R49 Y53 N99 V102 T103 N106
Binding affinityPDBbind-CN: Kd=110nM
Enzymatic activity
Enzyme Commision number ?
External links