Structure of PDB 3osf Chain A Binding Site BS01

Receptor Information
>3osf Chain A (length=103) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKQKFTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRWKNYLAPS
ISHTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNRWVTISNK
LGI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3osf Molecular basis of the recognition of the ap65-1 gene transcription promoter elements by a Myb protein from the protozoan parasite Trichomonas vaginalis.
Resolution2.032 Å
Binding residue
(original residue number in PDB)		K49 Q50 K51 R84 Q85 R89 Y93 N139
Binding residue
(residue number reindexed from 1)		K2 Q3 K4 R37 Q38 R42 Y46 N92
Binding affinityPDBbind-CN: Kd=32.3nM
Enzymatic activity
Enzyme Commision number ?
External links