Structure of PDB 3oqg Chain A Binding Site BS01

Receptor Information
>3oqg Chain A (length=176) Species: 585532 (Helicobacter pylori 118) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHEFMAKRKSDIILKSVDDLKDEIDYKDFEYKEYFNLLCELVPNNSLE
KLEINAIDEKNMKNEGLVYVFVIQGKIFKIGHSITPITKRVQSYNCGKVE
YRKNGTCSTTNYFVLQSLLKINKIVQVYAFFPEQPTYTLFGKTYQDSFST
SKRAENVILENFIKNHNKKPIGCTQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oqg Hpy188I-DNA pre- and post-cleavage complexes--snapshots of the GIY-YIG nuclease mediated catalysis.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		R4 S6 K73 G75 H76 S77 I78 R84 Q86 S87 C90 S102 T103 T104 K146 Q169 T170
Binding residue
(residue number reindexed from 1)		R10 S12 K79 G81 H82 S83 I84 R90 Q92 S93 C96 S108 T109 T110 K152 Q175 T176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:3oqg, PDBe:3oqg, PDBj:3oqg
PDBsum3oqg
PubMed20935048
UniProtQ9KJ88

[Back to BioLiP]