Structure of PDB 3ool Chain A Binding Site BS01

Receptor Information
>3ool Chain A (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDE
GKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGAQ
TFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYN
KNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ool Evolution of I-SceI Homing Endonucleases with Increased DNA Recognition Site Specificity.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		G13 N15 K17 D44 Y46 R48 R50 E61 W62 K63 N90 N94 V96 W149 D150 N152 K193
Binding residue
(residue number reindexed from 1)		G11 N13 K15 D42 Y44 R46 R48 E59 W60 K61 N88 N92 V94 W147 D148 N150 K191
Binding affinityPDBbind-CN: Kd=20nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ool, PDBe:3ool, PDBj:3ool
PDBsum3ool
PubMed21029741
UniProtP03882|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)

[Back to BioLiP]