Structure of PDB 3oll Chain A Binding Site BS01

Receptor Information

>3oll Chain A (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMIS
WAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLV
LDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMY
PLVTATADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLS
HVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAH

Ligand information

>3oll Chain C (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3oll Synthesis and crystal structure of a phosphorylated estrogen receptor ligand binding domain.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	I310 K314 V328 E332 D489 E493
Binding residue (residue number reindexed from 1)	I49 K53 V67 E71 D226 E230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3oll, PDBe:3oll, PDBj:3oll
PDBsum	3oll
PubMed	20922740
UniProt	Q92731\|ESR2_HUMAN Estrogen receptor beta (Gene Name=ESR2)

[Back to BioLiP]