Structure of PDB 3obx Chain A Binding Site BS01

Receptor Information
>3obx Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGTGSRELMNL
TGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDA
NGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>3obx Chain B (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEATAPPEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3obx Crystallographic and Functional Analysis of the ESCRT-I /HIV-1 Gag PTAP Interaction.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		D34 Y63 R64 Y68 N69 M95 P139 V141 F142 S143
Binding residue
(residue number reindexed from 1)		D32 Y58 R59 Y63 N64 M90 P134 V136 F137 S138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:3obx, PDBe:3obx, PDBj:3obx
PDBsum3obx
PubMed21070952
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]