Structure of PDB 3obu Chain A Binding Site BS01

Receptor Information
>3obu Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGTGSRELM
NLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHV
DANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>3obu Chain B (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEPTAPPEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3obu Crystallographic and Functional Analysis of the ESCRT-I /HIV-1 Gag PTAP Interaction.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		D34 T58 Y63 R64 Y68 N69 M95 V141 F142 S143
Binding residue
(residue number reindexed from 1)		D34 T55 Y60 R61 Y65 N66 M92 V138 F139 S140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:3obu, PDBe:3obu, PDBj:3obu
PDBsum3obu
PubMed21070952
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]