Structure of PDB 3obq Chain A Binding Site BS01

Receptor Information
>3obq Chain A (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGTGSRELMN
LTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVD
ANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3obq Crystallographic and Functional Analysis of the ESCRT-I /HIV-1 Gag PTAP Interaction.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Y63 Y68 N69 P139 V141 F142 S143
Binding residue
(residue number reindexed from 1)		Y59 Y64 N65 P135 V137 F138 S139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:3obq, PDBe:3obq, PDBj:3obq
PDBsum3obq
PubMed21070952
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]