Structure of PDB 3oak Chain A Binding Site BS01

Receptor Information
>3oak Chain A (length=151) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIDPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQ
KVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKS
LFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTR
P
Ligand information
>3oak Chain D (length=29) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FTHMSDKIDEMYDIFGDGHDYDWALEIEN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oak Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		E226 P227 L228 D230 T253 G262 R263 I266 F267 S271 K272 R273 T290 P292
Binding residue
(residue number reindexed from 1)		E85 P86 L87 D89 T112 G121 R122 I125 F126 S130 K131 R132 T149 P151
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3oak, PDBe:3oak, PDBj:3oak
PDBsum3oak
PubMed21094070
UniProtQ06505|IWS1_YEAST Transcription factor SPN1 (Gene Name=SPN1)

[Back to BioLiP]