Structure of PDB 3oa6 Chain A Binding Site BS01

Receptor Information
>3oa6 Chain A (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNG
WNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oa6 Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R65 W66
Binding residue
(residue number reindexed from 1)		R57 W58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3oa6, PDBe:3oa6, PDBj:3oa6
PDBsum3oa6
PubMed20657587
UniProtQ8N5Y2|MS3L1_HUMAN MSL complex subunit 3 (Gene Name=MSL3)

[Back to BioLiP]