Structure of PDB 3o7a Chain A Binding Site BS01

Receptor Information
>3o7a Chain A (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCR
DS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o7a PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
Resolution1.67 Å
Binding residue
(original residue number in PDB)		F241 G243 P245 M246 I247 E248 W255 K265 E270
Binding residue
(residue number reindexed from 1)		F13 G15 P17 M18 I19 E20 W27 K37 E42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3o7a, PDBe:3o7a, PDBj:3o7a
PDBsum3o7a
PubMed27223324
UniProtQ86YI8|PHF13_HUMAN PHD finger protein 13 (Gene Name=PHF13)

[Back to BioLiP]