Structure of PDB 3o3h Chain A Binding Site BS01

Receptor Information
>3o3h Chain A (length=222) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSP
AKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKP
SFVLVNGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRM
YPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFF
EKGLISENRFERILNLLGARKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o3h Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G23 N81 I82 F83 A164 F185 E186 P187
Binding residue
(residue number reindexed from 1)		G22 N80 I81 F82 A163 F184 E185 P186
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006298 mismatch repair
GO:0006401 RNA catabolic process
GO:0043137 DNA replication, removal of RNA primer
Cellular Component
GO:0005737 cytoplasm
GO:0032299 ribonuclease H2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o3h, PDBe:3o3h, PDBj:3o3h
PDBsum3o3h
PubMed21095591
UniProtQ9X017|RNH2_THEMA Ribonuclease HII (Gene Name=rnhB)

[Back to BioLiP]