Structure of PDB 3o2h Chain A Binding Site BS01

Receptor Information
>3o2h Chain A (length=95) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQL
MLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o2h The ClpS adaptor mediates staged delivery of N-end rule substrates to the AAA+ ClpAP protease.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		N34 D35 D36 Y37 T38 P39 M40 V43 M62 H66
Binding residue
(residue number reindexed from 1)		N23 D24 D25 Y26 T27 P28 M29 V32 M51 H55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0051087 protein-folding chaperone binding
GO:0140678 molecular function inhibitor activity
Biological Process
GO:0006508 proteolysis
GO:0009408 response to heat
GO:0030163 protein catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3o2h, PDBe:3o2h, PDBj:3o2h
PDBsum3o2h
PubMed21777811
UniProtP0A8Q6|CLPS_ECOLI ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]